PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.L01064.1.p
Common NameEUGRSUZ_L01064
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Nin-like
Protein Properties Length: 188aa    MW: 21832.1 Da    PI: 8.7691
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.L01064.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK635.1e-2095141450
            RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50 
                       +++l d+  yF+lpi++A   L +c+T++K+iCR+ G+ RWP+Rki+
  Eucgr.L01064.1.p  95 KMTLADVGGYFHLPIEKAFERLHLCPTIVKKICRKGGVGRWPYRKIQ 141
                       7999******************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.25583163IPR003035RWP-RK domain
PfamPF020422.6E-1795141IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MVSHAILDTQ HNPGAVPSNG EDRYQMFDFC KKSIQNVKDF LQQYCEGRRL AGYIMYQDPL  60
AMFYEAVCVG IDFNGNVNAD YFQLPLPPTR ERAGKMTLAD VGGYFHLPIE KAFERLHLCP  120
TIVKKICRKG GVGRWPYRKI QCIERKILEL REQLKREDEP KRSRTQAEID EWQRNLDKIR  180
YGVARTD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010024146.11e-132PREDICTED: protein RKD5-like
TrEMBLA0A058ZV011e-140A0A058ZV01_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40762342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.11e-09NIN like protein 7